Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG357114.1 | 5prime_partial | 158 | 3-479(+) |
Amino Acid sequence : | |||
SNQQGRPKITKSLFSVLHIYLSMCLVLHISTAQATRVQYCDKKGNYAVKVQGVVISPNPVVSGQPATFNITASTGKAIPNGRVVIEVAYLGVRVHTETHDLNEEVPCPVAPGNLVLSHSQ NLPGITPPGNYKLKMIMEDEQHQQLTCISFTFKIAVRS* | |||
Physicochemical properties | |||
Number of amino acids: | 158 | ||
Molecular weight: | 17,236.747 | ||
Theoretical pI: | 9.138 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7700 | ||
Instability index: | 44.408 | ||
aromaticity | 0.057 | ||
GRAVY | -0.041 | ||
Secondary Structure Fraction | |||
Helix | 0.316 | ||
turn | 0.266 | ||
sheet | 0.190 |