Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG357116.1 | internal | 101 | 2-304(+) |
Amino Acid sequence : | |||
SVKDSVKEEKLKDKPGYEHLNEPLHLLLEAEFPEDTINARLDHAVRILENLLKPVDESLDQYKKQQLRELAMLNGTLREESPSMSPSMSPSMSPFNSTGMK | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 11,492.946 | ||
Theoretical pI: | 5.161 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 64.824 | ||
aromaticity | 0.040 | ||
GRAVY | -0.753 | ||
Secondary Structure Fraction | |||
Helix | 0.248 | ||
turn | 0.267 | ||
sheet | 0.356 |