Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG357180.1 | 5prime_partial | 138 | 1-417(+) |
Amino Acid sequence : | |||
CPNLLPSMLILSHSGLFLSILVGTRVSRMSSVYFFDFATVTVSTVTGWCVITSFLLSALAGAGFLLFLIEWVKKCLDFSATLFIIHLFVCIIYGGWPSSMTWWVVNGTGLAIMALLGEYL CRRRELQEIPITRYRASV* | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 15,409.216 | ||
Theoretical pI: | 8.731 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33710 | ||
Instability index: | 33.908 | ||
aromaticity | 0.138 | ||
GRAVY | 0.918 | ||
Secondary Structure Fraction | |||
Helix | 0.457 | ||
turn | 0.217 | ||
sheet | 0.268 |