Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG357199.1 | 5prime_partial | 203 | 2-613(+) |
Amino Acid sequence : | |||
ETMENETALNLCNLPDTETVSKPSATKMVLDLSIADQPTAVYNPPVESVGNDTIICGEEAVESKVLTENISIEENISTRNGVLNEDPEIDPQNSCRKASIDVKEERTENGSLNSPKLPSY MAATQSAKAKLRIQGSPRFGQDGIEKSNPVRRHSLPSLTHNKLNSQSPRTQRLVQSGSKGGNKGNRYVPSNGSAKVTQAEWKR* | |||
Physicochemical properties | |||
Number of amino acids: | 203 | ||
Molecular weight: | 22,102.311 | ||
Theoretical pI: | 6.244 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 60.730 | ||
aromaticity | 0.025 | ||
GRAVY | -0.817 | ||
Secondary Structure Fraction | |||
Helix | 0.207 | ||
turn | 0.330 | ||
sheet | 0.232 |