Acc_NO	ORF type	length	start-end position (strand +/-)
>FG357207.1	complete	100	1-303(+)
Amino Acid sequence :
MGDDHDYFEKGNLDIFSGRGVCLNAPVCSILITSDNTGDLPGWYVEYVEITTAGLHVPAESIQFKLNQWLAVDEPPFELTAYRDYCPSTTYSQYPSVLIS*
Physicochemical properties
Number of amino acids:		100
Molecular weight:		11,171.325
Theoretical pI:		4.114
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		21430 21555
Instability index:		32.365
aromaticity		0.130
GRAVY		-0.127
Secondary Structure Fraction
Helix		0.350
turn		0.260
sheet		0.210