Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG357218.1 | 5prime_partial | 131 | 2-397(+) |
Amino Acid sequence : | |||
KPISYLNVRPPNNNTSTLFGALAMIDDPITEGPELSSKLLGKAQGFYGSASQQEVALLMAMNFYXVQGKYNGSTITILGRNPVFNKVREMPVIGGSGLFRFARGYAQASTHIFDPATGDA TVEYNVYVMHY* | |||
Physicochemical properties | |||
Number of amino acids: | 131 | ||
Molecular weight: | 14,187.986 | ||
Theoretical pI: | 8.170 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 11920 | ||
Instability index: | 44.334 | ||
aromaticity | 0.115 | ||
GRAVY | -0.107 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.300 | ||
sheet | 0.238 |