Acc_NO	ORF type	length	start-end position (strand +/-)
>FG357233.1	5prime_partial	130	1-393(+)
Amino Acid sequence :
LLPAAITLFGLHEQGCVSRINNVAQGFNKKMNSTVANLQKQLSGLKIVVFDIYTPLYDVVKSPSKYGFAEERRGCCGTGTVETTSFLCNPSSIGTCSNATQYVFWDSVHPSQAANQVLAD ALIVQGLSLI*
Physicochemical properties
Number of amino acids:		130
Molecular weight:		13,987.856
Theoretical pI:		7.805
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11460 11710
Instability index:		35.057
aromaticity		0.085
GRAVY		0.148
Secondary Structure Fraction
Helix		0.331
turn		0.269
sheet		0.215