Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG357234.1 | 5prime_partial | 135 | 1-408(+) |
Amino Acid sequence : | |||
TLAHTHTNRSLVVGIIGIFFNVIMYASPLSVMKLVITTKSVEFMPFFLSLTSFANGIAWGTYALILFDPFITVPNGLGTLSGLLQLSLYAAYYKSTIRQMAARKEKFQVEMAVADHHAIV DVNHDAKKSGTTATP* | |||
Physicochemical properties | |||
Number of amino acids: | 135 | ||
Molecular weight: | 14,783.111 | ||
Theoretical pI: | 9.301 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 26.096 | ||
aromaticity | 0.111 | ||
GRAVY | 0.439 | ||
Secondary Structure Fraction | |||
Helix | 0.370 | ||
turn | 0.207 | ||
sheet | 0.267 |