Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG357276.1 | complete | 104 | 58-372(+) |
Amino Acid sequence : | |||
MGVASRLMLVVVLMIAITSNEVVKVANAQSICNASVSDLMACKSSVTAPNPTPPSASCCSVLSHADLSCLCSYKNSNVLPSLGIDPKLAMQLPAKCKLPHPANC* | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 10,742.671 | ||
Theoretical pI: | 8.474 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1990 | ||
Instability index: | 41.302 | ||
aromaticity | 0.010 | ||
GRAVY | 0.486 | ||
Secondary Structure Fraction | |||
Helix | 0.269 | ||
turn | 0.317 | ||
sheet | 0.288 |