Acc_NO	ORF type	length	start-end position (strand +/-)
>FG357283.1	complete	101	35-340(+)
Amino Acid sequence :
MVDKLPTDLEGMEASMERLLALIDDVYKYVDNVVEGHIEPDNNIGRFISDTMASLPKLSPVAFDKLVNDSLQDQLLLLYLSSITRTQLSLAEKLNTAAQIL*
Physicochemical properties
Number of amino acids:		101
Molecular weight:		11,250.810
Theoretical pI:		4.327
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		4470 4470
Instability index:		35.642
aromaticity		0.050
GRAVY		0.054
Secondary Structure Fraction
Helix		0.356
turn		0.198
sheet		0.347