Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG357284.1 | internal | 138 | 1-414(+) |
Amino Acid sequence : | |||
RFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGATVNLGLWDTAGQEDYNRLRPLSYRGADVLLLAFSLISKASYENVPKKWIPELKHYAPGVPIVLVGTKLDLRD DKQFFIDHPGAVPISAAQ | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 15,104.119 | ||
Theoretical pI: | 6.913 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
Instability index: | 19.814 | ||
aromaticity | 0.109 | ||
GRAVY | 0.078 | ||
Secondary Structure Fraction | |||
Helix | 0.370 | ||
turn | 0.246 | ||
sheet | 0.203 |