Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FJ232955.1 | 5prime_partial | 232 | 1-699(+) |
Amino Acid sequence : | |||
EVSWAPLPLVLLTDASSNISRLSPTLPFPSTFSLLPFLFKLRSSSLLPTMASEIEITKKNKGGARPKRPRDTGNQTPCYRGVRMRAWGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDV AALSIKGPAAILNFPDLAASLPRPVSLSPRDVQAAAASAAAMEPEGGGNAAAVEELGEIVELPKLDGELFDNLESSEFVCYDSSFECSFAYYHPPWMEGADDLGGLLWDYKF* | |||
Physicochemical properties | |||
Number of amino acids: | 232 | ||
Molecular weight: | 25,399.719 | ||
Theoretical pI: | 5.561 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40450 40575 | ||
Instability index: | 54.985 | ||
aromaticity | 0.095 | ||
GRAVY | -0.193 | ||
Secondary Structure Fraction | |||
Helix | 0.284 | ||
turn | 0.284 | ||
sheet | 0.319 |