| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >FJ232955.1 | 5prime_partial | 232 | 1-699(+) |
Amino Acid sequence : | |||
| EVSWAPLPLVLLTDASSNISRLSPTLPFPSTFSLLPFLFKLRSSSLLPTMASEIEITKKNKGGARPKRPRDTGNQTPCYRGVRMRAWGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDV AALSIKGPAAILNFPDLAASLPRPVSLSPRDVQAAAASAAAMEPEGGGNAAAVEELGEIVELPKLDGELFDNLESSEFVCYDSSFECSFAYYHPPWMEGADDLGGLLWDYKF* | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 25,399.719 | ||
| Theoretical pI: | 5.561 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40450 40575 | ||
| Instability index: | 54.985 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.193 | ||
Secondary Structure Fraction | |||
| Helix | 0.284 | ||
| turn | 0.284 | ||
| sheet | 0.319 | ||