Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FJ235343.1 | internal | 195 | 3-587(+) |
Amino Acid sequence : | |||
KVRMICDCQAPPVKVVQDKRLAQPLSLCGSTMRSPHGXHAQYMANMGXIASLVMSVTINEDDEETVNDQQIGRKLWGLVVCHHTNPRFVPFPXRYACEFLMQVFGVQXNREVELAXQTKE KHILQTQTVLCDMLLRDAPVAIVTRSPNVMDLVKCDGAALYYRKKFWMLGVTPTEAQIKDITEWLLEYHGESTGL | |||
Physicochemical properties | |||
Number of amino acids: | 195 | ||
Molecular weight: | 21,533.828 | ||
Theoretical pI: | 6.646 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24325 | ||
Instability index: | 47.631 | ||
aromaticity | 0.068 | ||
GRAVY | -0.150 | ||
Secondary Structure Fraction | |||
Helix | 0.305 | ||
turn | 0.174 | ||
sheet | 0.263 |