Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FJ402836.2 | 5prime_partial | 129 | 3-392(+) |
Amino Acid sequence : | |||
QAWNHQFFWESMKPNGGGEPSGELLELINRDFGSYDTFVKEFKTAAATQFGSGWAWLAYKPEDKKLALVKTPSAENPLVLGYTPLLTIDVWEHAYYLDFQNRRPDYISIFMEKLVSWEAV SSRLKAATA* | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 14,741.480 | ||
Theoretical pI: | 5.359 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41940 41940 | ||
Instability index: | 20.478 | ||
aromaticity | 0.155 | ||
GRAVY | -0.345 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.225 | ||
sheet | 0.295 |