Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FJ402837.1 | 5prime_partial | 168 | 2-508(+) |
Amino Acid sequence : | |||
CPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEIYPIPSKVCSGKREKCIIQKENNFKQAGERYRTFTPDRQE RFVRRWVEPLSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI* | |||
Physicochemical properties | |||
Number of amino acids: | 168 | ||
Molecular weight: | 11,409.435 | ||
Theoretical pI: | 11.342 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 46.730 | ||
aromaticity | 0.099 | ||
GRAVY | 0.052 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.218 | ||
sheet | 0.297 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FJ402837.1 | complete | 101 | 189-494(+) |
Amino Acid sequence : | |||
MRRSTTSLQGMIKFAMLRYILFLQKFAVANARSVSFRKRTISSKQEKGTAHSHPTDKNALFVDGWNPCLILASLMKYAAFGSRTGLRLTNLWVKSLLLGLM* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 11,409.435 | ||
Theoretical pI: | 11.342 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 46.730 | ||
aromaticity | 0.099 | ||
GRAVY | 0.052 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.218 | ||
sheet | 0.297 |