Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FJ560460.1 | 5prime_partial | 214 | 1-645(+) |
Amino Acid sequence : | |||
QQLMISRAMQARNYNLGVRSQPMKLAAAAAPPQPKPTKLYRGVRQRHWGKWVVEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGDYARLNFPHLKHTSAHLAPGGPLHSSVDAKLQ AICQSLEQNKSSNSNSSKKEKRGDAVEEKSDKVVVVVAEGEESCSSSSMNTGSASSPSSEIESLDFTEVPWDESEDFVLRKYPSWEIDWDAILS* | |||
Physicochemical properties | |||
Number of amino acids: | 214 | ||
Molecular weight: | 23,874.547 | ||
Theoretical pI: | 8.480 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41940 42065 | ||
Instability index: | 56.179 | ||
aromaticity | 0.075 | ||
GRAVY | -0.652 | ||
Secondary Structure Fraction | |||
Helix | 0.248 | ||
turn | 0.262 | ||
sheet | 0.280 |