Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FJ979918.1 | 5prime_partial | 168 | 3-509(+) |
Amino Acid sequence : | |||
PIREQFPTLSYADFHQLAGVVAVEVTGGPDVPFHPGREDKPEPPVEGRLPDATKGSDHLRDVFVKQMGLSDKDIVALSGAHTLGRCHKERSGFEGPWTANPLIFDNSYFKELLSGEKEGL LQLPSDKALLSDPAFRPLVEKYAADEDAFFADYAEAHLKLSELGFAEA* | |||
Physicochemical properties | |||
Number of amino acids: | 168 | ||
Molecular weight: | 18,420.408 | ||
Theoretical pI: | 4.835 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
Instability index: | 31.132 | ||
aromaticity | 0.095 | ||
GRAVY | -0.383 | ||
Secondary Structure Fraction | |||
Helix | 0.286 | ||
turn | 0.238 | ||
sheet | 0.310 |