Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FN668786.1 | internal | 108 | 1-324(+) |
Amino Acid sequence : | |||
ATYLSEKIGYWRYITIYRHLKSNPEFICYPIFKYFENWCQDENRHGDFFSALMKAQPQFLDDWKAKLWARFFCLSVTTCTELSFHYDQPTIRVSLYDNNLMFYYQNAG | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 13,174.820 | ||
Theoretical pI: | 7.021 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36900 37150 | ||
Instability index: | 32.316 | ||
aromaticity | 0.222 | ||
GRAVY | -0.403 | ||
Secondary Structure Fraction | |||
Helix | 0.380 | ||
turn | 0.176 | ||
sheet | 0.204 |