| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >FR719057.1 | internal | 270 | 1-810(+) |
Amino Acid sequence : | |||
| FVLDILIPRSVHVEILIQTLRHWVKDVSSLHLLRVFLNEYWNWNSLLTPKKVSFSLSKRNQRLFFFLYNSHVCEYESIFVFLRNQSFHLRSTSSGVLLERIYFYIKIERLMNVFVKDFRA NLWLVEEPCMHYIRYQRKSILASKGTSLFMNKWKLNLVTFWQWHFSVWFHPRRIWINQFPKHSLEILGYLSNVQMNPSVVRSQILENSFLINNAIKKLDTLVPIIPLITELAKAKFCNVL GHPISKPIRAELSDSNIIDRFSRICRNISH | |||
Physicochemical properties | |||
| Number of amino acids: | 270 | ||
| Molecular weight: | 32,296.529 | ||
| Theoretical pI: | 10.012 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 61420 61670 | ||
| Instability index: | 44.920 | ||
| aromaticity | 0.137 | ||
| GRAVY | 0.040 | ||
Secondary Structure Fraction | |||
| Helix | 0.433 | ||
| turn | 0.222 | ||
| sheet | 0.211 | ||