Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FR719060.1 | internal | 270 | 1-810(+) |
Amino Acid sequence : | |||
FVLDILIPRSVHVEILIQTLRHWVKDVSSLHLLRVFLNEYWNWNSLLTPKKVSFSLSKRNQRLFFFLYNSHVCEYESIFVFLRNQSFHLRSTSSGVLLERIYFYIKIERLMNVFVKDFRA NLWLVEEPCMHYIRYQRKSILASKGTSLFMNKWKLNLVTFWQWHFSVWFHPRRIWINQFPKHSLEILGYLSNVQMNPSVVRSQILENSFLINNAIKKLDTLVPIIPLIAELAKAKFCNVL GHPISKPIRAELSDSNIIDRFSRICRNISH | |||
Physicochemical properties | |||
Number of amino acids: | 270 | ||
Molecular weight: | 32,266.503 | ||
Theoretical pI: | 10.012 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 61420 61670 | ||
Instability index: | 44.206 | ||
aromaticity | 0.137 | ||
GRAVY | 0.049 | ||
Secondary Structure Fraction | |||
Helix | 0.433 | ||
turn | 0.222 | ||
sheet | 0.215 |