Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FR719068.1 | internal | 267 | 1-801(+) |
Amino Acid sequence : | |||
FVLDILIPHSVHVEILIQTLRYWVKDVSSLHLLRVFLNQYCSLITSKKVSSSLSKRNQRFFFFLYNSHVCEYESIFVFLRNQSFHLRSTSYGVLLERIYFYIKIEHLVNVFVKDFRANLW LIEEPCMHYIRYQGKSILASKGTSLFMNKWKFYLVTSWERHFLVWFHPRRICINQFSKHSLEIFGYLSNVQTGPSVVRSQILENAFLINNAIKKLDTPVPIIPLIAKLAKEKFCNVLGHP TSKPIWGDLSDSNIIDRFGRICRNISH | |||
Physicochemical properties | |||
Number of amino acids: | 267 | ||
Molecular weight: | 31,537.526 | ||
Theoretical pI: | 9.674 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 49390 49765 | ||
Instability index: | 41.232 | ||
aromaticity | 0.142 | ||
GRAVY | 0.084 | ||
Secondary Structure Fraction | |||
Helix | 0.431 | ||
turn | 0.221 | ||
sheet | 0.187 |