Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FR719101.1 | internal | 270 | 1-810(+) |
Amino Acid sequence : | |||
FVLDILIPRSVHVEILIQTLRLWVKDVSSLHLLRVFLNEYWNWNSLLTTKKVSFSLLKRNQRLFFFLYNSHVCEYESIFVFLRNQFFHLRSTSSGVLLERIYFSIKIERLMNVFVKDFRT NLGLVEEPCMHYIRYQRKSILASKGTSFFVNKWKFYLVTFWQWHFSVWFHPKRISINQFSKHSLEFLGYLSNVQMNPSVVRSQILENAFLINNSIKKLDTLVPIIPLIAELAKAKFCNVF GHPISKPIRADLSDYNIIDRFARICRNISH | |||
Physicochemical properties | |||
Number of amino acids: | 270 | ||
Molecular weight: | 32,219.415 | ||
Theoretical pI: | 9.950 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 51910 52160 | ||
Instability index: | 36.163 | ||
aromaticity | 0.152 | ||
GRAVY | 0.116 | ||
Secondary Structure Fraction | |||
Helix | 0.444 | ||
turn | 0.211 | ||
sheet | 0.204 |