Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FR720482.1 | internal | 163 | 1-489(+) |
Amino Acid sequence : | |||
VGTGLERQAALDSGALAIAERGGKIIYIDTDKILFSGNGDTLSISLVMYQRSNKNTCMHQKPQVRRGKCIKKGQILADGAATVGGELALGKNVLVAYMPWEGYNFEDAVLISDRLVYEDI YTSFHIRKYEIQTHVTSQGPERITNEIPHLEAHLLRNLDKNGI | |||
Physicochemical properties | |||
Number of amino acids: | 163 | ||
Molecular weight: | 18,058.410 | ||
Theoretical pI: | 7.116 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
Instability index: | 26.845 | ||
aromaticity | 0.067 | ||
GRAVY | -0.265 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.221 | ||
sheet | 0.252 |