Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FR720534.1 | internal | 183 | 1-549(+) |
Amino Acid sequence : | |||
DILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPVAYVKTFQGPPHG IQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDR | |||
Physicochemical properties | |||
Number of amino acids: | 183 | ||
Molecular weight: | 20,465.080 | ||
Theoretical pI: | 7.810 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30160 | ||
Instability index: | 36.311 | ||
aromaticity | 0.109 | ||
GRAVY | -0.354 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.235 | ||
sheet | 0.230 |