Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FR831952.1 | internal | 233 | 1-699(+) |
Amino Acid sequence : | |||
AGVKDYRLTYYTPQYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVPGEETQFIAYVAYPLDLFEEGSVTNLFTSIVGNVFGFKALRALR LEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFCFCAEAIYKAQAETGEIKGHYLNATAGTC | |||
Physicochemical properties | |||
Number of amino acids: | 233 | ||
Molecular weight: | 25,937.005 | ||
Theoretical pI: | 6.228 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37360 37735 | ||
Instability index: | 31.397 | ||
aromaticity | 0.120 | ||
GRAVY | -0.393 | ||
Secondary Structure Fraction | |||
Helix | 0.296 | ||
turn | 0.219 | ||
sheet | 0.240 |