Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FR832770.1 | internal | 218 | 3-656(+) |
Amino Acid sequence : | |||
KIYFWFFYNSYVFEFEFLVVFLRKQSYYLQSTSFGSFLDRRHFYGKMEHLINVCRNYSQKTLRFFKDPFMHYIRYQGKAILASRDTHILMKKWKYYLVNFWQYYFNFWSYPYRIHINQLK NHSFLFGGYFSSVLINPLTVKNKMLDHSFLIDTVTKKFDTTIPVIPLIGSLSKAKFCTVSGHPNSKTIWADLSDSDIVGRFGRICRNLSHYYSGSSKK | |||
Physicochemical properties | |||
Number of amino acids: | 218 | ||
Molecular weight: | 26,242.050 | ||
Theoretical pI: | 9.802 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 54320 54445 | ||
Instability index: | 42.346 | ||
aromaticity | 0.211 | ||
GRAVY | -0.217 | ||
Secondary Structure Fraction | |||
Helix | 0.417 | ||
turn | 0.225 | ||
sheet | 0.138 |