Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GE650048.1 | 5prime_partial | 128 | 1-387(+) |
Amino Acid sequence : | |||
KLFFLGGAEKEKIIRLFLDMENSAFLLTPSDLHFMQSSTSSFASSTSSTTSDAQSAPPELTQLFRDIRKNSAELLRLSGRDVPERWNIADLVEAVIGDDALLIPGHLQDTYYDVLSKGCS SWLFKDLS* | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 14,232.885 | ||
Theoretical pI: | 4.765 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 44.338 | ||
aromaticity | 0.094 | ||
GRAVY | -0.137 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.250 | ||
sheet | 0.289 |