Acc_NO	ORF type	length	start-end position (strand +/-)
>GE650048.1	5prime_partial	128	1-387(+)
Amino Acid sequence :
KLFFLGGAEKEKIIRLFLDMENSAFLLTPSDLHFMQSSTSSFASSTSSTTSDAQSAPPELTQLFRDIRKNSAELLRLSGRDVPERWNIADLVEAVIGDDALLIPGHLQDTYYDVLSKGCS SWLFKDLS*
Physicochemical properties
Number of amino acids:		128
Molecular weight:		14,232.885
Theoretical pI:		4.765
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		13980 13980
Instability index:		44.338
aromaticity		0.094
GRAVY		-0.137
Secondary Structure Fraction
Helix		0.320
turn		0.250
sheet		0.289