Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GN346784.1 | internal | 117 | 3-353(+) |
Amino Acid sequence : | |||
VRLLKMHGYDVDPNVLKHFKQQDGKFSCYIGQSVESASPMYNLYRAAQLRFPGEEVLEEATKFAFNFLQEMLVKDRLQERWVISDHLFDEIKLGLKMPWYATLPRVEAAYYLDHYAG | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 13,765.641 | ||
Theoretical pI: | 6.080 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 22920 | ||
Instability index: | 65.326 | ||
aromaticity | 0.145 | ||
GRAVY | -0.344 | ||
Secondary Structure Fraction | |||
Helix | 0.359 | ||
turn | 0.162 | ||
sheet | 0.308 |