Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GQ202143.1 | complete | 497 | 3-1496(+) |
Amino Acid sequence : | |||
MDPLLRTHNRLELLQPLHKLAESHFLSPSPKRPNHIPIKKSHKRWCKDGSFKVSNSALLDLVPETKKEHLEFDLPSYDPSKALTLDLAVVGGGPAGLAVAQQVSEAGLSVVSIDPNPNVI WPNNYGVWVDEFEAMGLLDCLDASWLGAVVHVDEKNKKLLDRPYARVNRKNLKTKMMQKCLANGVKFHQAKVVKVVHEDEKSLLICNDGITIEATVVLDATGFSRCLVQYDKPYNPGYQV AYGILAEVEEHPLDLDKMVFMDWRDSHLKGNGVMQGRNNRIPTFLYAMPFSSNRIFLEETSLVARPGLGMEDIQQRMEARLKHLGIKVKSIEEDERCVIPMGGPLPVLPQRVVGIGGTAG MVHPSTGYMVARTLAVAPIVADSIVRFLGSDRGLSGDMLSAEVWKDLWPIERRRQREFFCFGMDILLKLDLEGTRRFFDAFFDLEPRYWHGFLSSRLFLLSFWFWASLFTCFNVLVESWQ GTLLGNMIELYEKDRCS* | |||
Physicochemical properties | |||
Number of amino acids: | 497 | ||
Molecular weight: | 14,838.738 | ||
Theoretical pI: | 10.334 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 51.283 | ||
aromaticity | 0.053 | ||
GRAVY | -0.693 | ||
Secondary Structure Fraction | |||
Helix | 0.235 | ||
turn | 0.318 | ||
sheet | 0.205 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GQ202143.1 | complete | 136 | 593-183(-) |
Amino Acid sequence : | |||
MYDFHNFGLVEFNTICEALLHHLGLEILTVDPGIRPVKEFLVLLIDMNYRAKPRSIKAVQKAHGFKLIDPNTIIVRPNDVRIRVNGDDREASLGYLLGHGKASGPPTDNSQIQGKSFGGV IRREIEFEVFLLGLRD* | |||
Physicochemical properties | |||
Number of amino acids: | 136 | ||
Molecular weight: | 14,838.738 | ||
Theoretical pI: | 10.334 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 51.283 | ||
aromaticity | 0.053 | ||
GRAVY | -0.693 | ||
Secondary Structure Fraction | |||
Helix | 0.235 | ||
turn | 0.318 | ||
sheet | 0.205 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GQ202143.1 | 5prime_partial | 132 | 1501-1103(-) |
Amino Acid sequence : | |||
FFYEHLSFSYSSIILPRRVPCHDSTRTLKHVNREAQNQKLSRNNLDDKKPCQYRGSKSKNASKNLLVPSKSSLSRISIPKQKNSLCLLLSMGQRSFQTSAESISPDSPRSEPRNRTIESA TIGATARVLATM* | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 14,838.738 | ||
Theoretical pI: | 10.334 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 51.283 | ||
aromaticity | 0.053 | ||
GRAVY | -0.693 | ||
Secondary Structure Fraction | |||
Helix | 0.235 | ||
turn | 0.318 | ||
sheet | 0.205 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GQ202143.1 | complete | 497 | 3-1496(+) |
Amino Acid sequence : | |||
MDPLLRTHNRLELLQPLHKLAESHFLSPSPKRPNHIPIKKSHKRWCKDGSFKVSNSALLDLVPETKKEHLEFDLPSYDPSKALTLDLAVVGGGPAGLAVAQQVSEAGLSVVSIDPNPNVI WPNNYGVWVDEFEAMGLLDCLDASWLGAVVHVDEKNKKLLDRPYARVNRKNLKTKMMQKCLANGVKFHQAKVVKVVHEDEKSLLICNDGITIEATVVLDATGFSRCLVQYDKPYNPGYQV AYGILAEVEEHPLDLDKMVFMDWRDSHLKGNGVMQGRNNRIPTFLYAMPFSSNRIFLEETSLVARPGLGMEDIQQRMEARLKHLGIKVKSIEEDERCVIPMGGPLPVLPQRVVGIGGTAG MVHPSTGYMVARTLAVAPIVADSIVRFLGSDRGLSGDMLSAEVWKDLWPIERRRQREFFCFGMDILLKLDLEGTRRFFDAFFDLEPRYWHGFLSSRLFLLSFWFWASLFTCFNVLVESWQ GTLLGNMIELYEKDRCS* | |||
Physicochemical properties | |||
Number of amino acids: | 497 | ||
Molecular weight: | 14,838.738 | ||
Theoretical pI: | 10.334 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 51.283 | ||
aromaticity | 0.053 | ||
GRAVY | -0.693 | ||
Secondary Structure Fraction | |||
Helix | 0.235 | ||
turn | 0.318 | ||
sheet | 0.205 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GQ202143.1 | complete | 136 | 593-183(-) |
Amino Acid sequence : | |||
MYDFHNFGLVEFNTICEALLHHLGLEILTVDPGIRPVKEFLVLLIDMNYRAKPRSIKAVQKAHGFKLIDPNTIIVRPNDVRIRVNGDDREASLGYLLGHGKASGPPTDNSQIQGKSFGGV IRREIEFEVFLLGLRD* | |||
Physicochemical properties | |||
Number of amino acids: | 136 | ||
Molecular weight: | 14,838.738 | ||
Theoretical pI: | 10.334 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 51.283 | ||
aromaticity | 0.053 | ||
GRAVY | -0.693 | ||
Secondary Structure Fraction | |||
Helix | 0.235 | ||
turn | 0.318 | ||
sheet | 0.205 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GQ202143.1 | 5prime_partial | 132 | 1501-1103(-) |
Amino Acid sequence : | |||
FFYEHLSFSYSSIILPRRVPCHDSTRTLKHVNREAQNQKLSRNNLDDKKPCQYRGSKSKNASKNLLVPSKSSLSRISIPKQKNSLCLLLSMGQRSFQTSAESISPDSPRSEPRNRTIESA TIGATARVLATM* | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 14,838.738 | ||
Theoretical pI: | 10.334 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 51.283 | ||
aromaticity | 0.053 | ||
GRAVY | -0.693 | ||
Secondary Structure Fraction | |||
Helix | 0.235 | ||
turn | 0.318 | ||
sheet | 0.205 |