Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GQ241339.1 | complete | 138 | 685-1101(+) |
Amino Acid sequence : | |||
MRQLFRLSSPCSMDHQQSFGWLNSKITQNLNQQSSQLQCKPKNESKHEKQVPVIEWTVVMRPSTMPNLSLMTCQNYKQELISRDTIKSFELKTEERQSIRPWPMGRGNWWCNWRSKQCRT QACIPSHSHPQQTWEHLC* | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 16,431.631 | ||
Theoretical pI: | 9.396 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39990 40365 | ||
Instability index: | 56.696 | ||
aromaticity | 0.080 | ||
GRAVY | -0.951 | ||
Secondary Structure Fraction | |||
Helix | 0.225 | ||
turn | 0.261 | ||
sheet | 0.181 |