Acc_NO	ORF type	length	start-end position (strand +/-)
>GQ241384.1	5prime_partial	135	432-25(-)
Amino Acid sequence :
RPKFSAPPPPPNLARLQALNNSPHQTSRTSAPPPPPPPPPPLPAQATSKPRNRWDSEGVAAVKPAQIVAKPQTWNSEAKVAADNGSAEKVDKDESFVGDDSGGAKPKLKPLHWDKVLATS ERATVWDQLKSSSFQ*
Physicochemical properties
Number of amino acids:		135
Molecular weight:		14,466.028
Theoretical pI:		9.695
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		22000 22000
Instability index:		49.290
aromaticity		0.052
GRAVY		-0.900
Secondary Structure Fraction
Helix		0.178
turn		0.356
sheet		0.222