Acc_NO	ORF type	length	start-end position (strand +/-)
>GQ248181.1	internal	236	2-709(+)
Amino Acid sequence :
NDYWSLSTLKKASLKRNQRFFLFLYNSHVCEYESIFVFLRNQSSHLQSTSFGVLLERIHFYGKIECLGSVFLKVTDCQANLWLVKEPCMHYVRYQRKCILSSKGTSLFMNKWKCYLVTFW QWHFCLWFHSRRISINPLYNHLLEFVGYLSSARMYPAMVRSQILENSFLINNAIKKVDALIPIMPMVTSLAKAQFCNLLGHPTSKPIWADLSDSNIINRFGHICRNISHFYSGSSK
Physicochemical properties
Number of amino acids:		236
Molecular weight:		27,721.059
Theoretical pI:		9.559
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		54890 55390
Instability index:		48.745
aromaticity		0.148
GRAVY		-0.008
Secondary Structure Fraction
Helix		0.386
turn		0.242
sheet		0.212