| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >GQ248675.1 | internal | 184 | 2-553(+) |
Amino Acid sequence : | |||
| SVGFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEADQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKA LRALRLEDLRIPVAYVKTFQGPPHGIQSERDKLNKYGRPLLGCTIKPKLGLSAKNYGRACYECL | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 20,377.983 | ||
| Theoretical pI: | 6.702 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30620 | ||
| Instability index: | 34.100 | ||
| aromaticity | 0.120 | ||
| GRAVY | -0.274 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.228 | ||
| sheet | 0.245 | ||