Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GQ248715.1 | internal | 128 | 2-385(+) |
Amino Acid sequence : | |||
LSRSEKCIVGTGLERQAALDSGVSAIAECEGKIIYTDTHKIVLSGHGDTISIPLVMYQRSNKNTCMHQNPQVRRGKCIKKGQILADGAATVGGELALGKNVLVAYMPWEGYNFEDAVLIS ERLVYEDI | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 13,938.855 | ||
Theoretical pI: | 6.331 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
Instability index: | 38.673 | ||
aromaticity | 0.055 | ||
GRAVY | -0.105 | ||
Secondary Structure Fraction | |||
Helix | 0.305 | ||
turn | 0.227 | ||
sheet | 0.258 |