| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >GQ248842.1 | internal | 128 | 2-385(+) |
Amino Acid sequence : | |||
| LSRSEKCIVGTGLERQAALDSGALAIAERGGKIVSINNDKILFSGNGDTLRIPLVMYQRSNKNTCMHQKPRVQQGKWIKKGQILADGAATVGGELALGKNVLVVYMPWEGYNFEDAVLIS ERLVYEDV | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 14,006.977 | ||
| Theoretical pI: | 8.603 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 31.419 | ||
| aromaticity | 0.063 | ||
| GRAVY | -0.154 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.242 | ||
| sheet | 0.266 | ||