Acc_NO	ORF type	length	start-end position (strand +/-)
>GQ273984.1	internal	128	2-385(+)
Amino Acid sequence :
LSRSEKCIVGTGLERQAALDSGALAIAEREGRVVYTNTDKILLAGNGDILSIPLVIYQRSNKNTCMHQKLQVPRGKCIKKGQILADGAATVGGELALGKNVLVAYMPWEGYNSEDAVLIS ERLVYEDI
Physicochemical properties
Number of amino acids:		128
Molecular weight:		13,846.799
Theoretical pI:		6.786
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12950 13075
Instability index:		33.830
aromaticity		0.047
GRAVY		-0.051
Secondary Structure Fraction
Helix		0.320
turn		0.227
sheet		0.297