Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GQ279096.1 | internal | 148 | 1-444(+) |
Amino Acid sequence : | |||
DDVYDIYGTLEELRLFRDIVQRWDIEAMDQLPHYMQMCFLAIDNFINEMAYDVLKEQEFVIIPHLRNKWSDLCASYFQEAEWYYNKYMPIMDEYINNACMSISTPLILSNTYFVVTNPID REVVQSFYKNHDVVRGSAMILRLPNDLG | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 17,674.003 | ||
Theoretical pI: | 4.428 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32890 33015 | ||
Instability index: | 57.097 | ||
aromaticity | 0.142 | ||
GRAVY | -0.166 | ||
Secondary Structure Fraction | |||
Helix | 0.385 | ||
turn | 0.176 | ||
sheet | 0.257 |