Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GQ279097.1 | internal | 148 | 1-444(+) |
Amino Acid sequence : | |||
DDVYDVYGTLEELQLFCDCFERWDIEAVDQLPHYMKICFLAINNFVNEMAYDVLKEQGFLIIPHLRKMWAYLCVGYFQEAKWYYDKYIPTMEEYINNACISISTHLILSNTYSLVTNPIE DEVVQNFYKDHDVVRCSAVILRLHNDLG | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 17,556.871 | ||
Theoretical pI: | 4.522 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34380 34755 | ||
Instability index: | 47.088 | ||
aromaticity | 0.149 | ||
GRAVY | -0.030 | ||
Secondary Structure Fraction | |||
Helix | 0.412 | ||
turn | 0.149 | ||
sheet | 0.250 |