Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GQ279098.1 | internal | 139 | 1-417(+) |
Amino Acid sequence : | |||
DDVYDVYGNLEELQLFYDVIQRWDIEAINQLPRYMQICYLALNNFIDEMAYDVLKEKGSVIIAHLKKIWTDLCSSYLQEAKWYSRGYTPTLEEYMDNAWISISAPVILSHLYFLVSNPID NEGNTAAQFGILRLHNDLG | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 16,207.186 | ||
Theoretical pI: | 4.418 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38390 38515 | ||
Instability index: | 41.325 | ||
aromaticity | 0.137 | ||
GRAVY | -0.107 | ||
Secondary Structure Fraction | |||
Helix | 0.403 | ||
turn | 0.194 | ||
sheet | 0.273 |