Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GQ434047.1 | internal | 261 | 2-784(+) |
Amino Acid sequence : | |||
ILVQILQCRIQDVPFLHLLRFFLHEYHNCNSLLITQNKSIYVFSNENKRLFQLLYNSYAFECEFLLVFFRKQSYYLRLTSSATFLERTHFYRKIEHLRIEHFFVVCRNYFHRTRWFFKNP FMHYVRYQRKAIVASRGTHFLMKKWKSHFVNFWQYYFRFWSRPYRIHINHLSNYSFYFLGYFSSLLINSSAVRNQMLENSFLMDTVTKKFDTIVPVILLIESLSKAKFCTVSGHPISKPI WADFSDSDIIDRFGRICRNLS | |||
Physicochemical properties | |||
Number of amino acids: | 261 | ||
Molecular weight: | 31,923.731 | ||
Theoretical pI: | 9.859 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 51340 51715 | ||
Instability index: | 44.343 | ||
aromaticity | 0.195 | ||
GRAVY | -0.090 | ||
Secondary Structure Fraction | |||
Helix | 0.429 | ||
turn | 0.188 | ||
sheet | 0.184 |