| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >GQ434048.1 | internal | 266 | 3-800(+) |
Amino Acid sequence : | |||
| PIHMEILVQILQCRIQDVPFLHLLRFFLHEYHNCNSLLITQNKSIYVFSNENKRLFQLLYNSYAFECEFLLVFFRKQSYYLRLTSSATFLERTHFYRKIEHLRIEHFFVVCRNYFHRTRW FFKNPFMHYVRYQRKAIVASRGTHFLMKKWKSHFVNFWQYYFRFWSRPYRIHINHLSNYSFYFLGYFSSLLINSSAVRNQMLENSFLMDTVTKKFDTIVPVILLIESLSKAKFCTVSGHP ISKPIWADFSDSDIIDRFGRICRNLS | |||
Physicochemical properties | |||
| Number of amino acids: | 266 | ||
| Molecular weight: | 32,531.453 | ||
| Theoretical pI: | 9.807 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 51340 51715 | ||
| Instability index: | 44.885 | ||
| aromaticity | 0.192 | ||
| GRAVY | -0.095 | ||
Secondary Structure Fraction | |||
| Helix | 0.425 | ||
| turn | 0.188 | ||
| sheet | 0.188 | ||