Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GQ434050.1 | internal | 272 | 1-816(+) |
Amino Acid sequence : | |||
DILIPYPIHMEILVQILQCRIQDVPFLHLLRFFLHEYHNCNSLLITQNKSIYVFSNENKRLFQLLYNSYAFECEFLLVFFRKQSYYLRLTSSATFLERTHFYRKIEHLRIEHFFVVCRNY FHRTRWFFKNPFMHYVRYQRKAIVASRGTHFLMKKWKSHFVNFWQYYFRFWSRPYRIHINHLSNYSFYFLGYFSSLLINSSAVRNQMLENSFLMDTVTKKFDTIVPVILLIESLSKAKFC TVSGHPISKPIWADFSDSDIIDRFGRICRNLS | |||
Physicochemical properties | |||
Number of amino acids: | 272 | ||
Molecular weight: | 33,246.302 | ||
Theoretical pI: | 9.730 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 52830 53205 | ||
Instability index: | 45.172 | ||
aromaticity | 0.191 | ||
GRAVY | -0.070 | ||
Secondary Structure Fraction | |||
Helix | 0.430 | ||
turn | 0.188 | ||
sheet | 0.188 |