Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GQ435495.1 | internal | 125 | 2-376(+) |
Amino Acid sequence : | |||
LTHLSFSIISIVITIHLTILLVQEIIGLRNSSEKGMIATFFSITGLLITRWISSRHFPLSNLYESLIFLSWSFSIIHMISKILNHKNDLSAITAPSAIFTQGFATSGLSSEMHQSARLVP ALQSQ | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 13,869.054 | ||
Theoretical pI: | 9.522 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
Instability index: | 59.089 | ||
aromaticity | 0.088 | ||
GRAVY | 0.580 | ||
Secondary Structure Fraction | |||
Helix | 0.400 | ||
turn | 0.264 | ||
sheet | 0.248 |