| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >GQ435495.1 | internal | 125 | 2-376(+) |
Amino Acid sequence : | |||
| LTHLSFSIISIVITIHLTILLVQEIIGLRNSSEKGMIATFFSITGLLITRWISSRHFPLSNLYESLIFLSWSFSIIHMISKILNHKNDLSAITAPSAIFTQGFATSGLSSEMHQSARLVP ALQSQ | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 13,869.054 | ||
| Theoretical pI: | 9.522 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 59.089 | ||
| aromaticity | 0.088 | ||
| GRAVY | 0.580 | ||
Secondary Structure Fraction | |||
| Helix | 0.400 | ||
| turn | 0.264 | ||
| sheet | 0.248 | ||