Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GQ435723.1 | internal | 122 | 3-368(+) |
Amino Acid sequence : | |||
ISFSIVSIVITIQLITFLVDEIVKLYDSSEKGIIVTFFCITGLLVTRWISSGHFPLSDLYESLIFLSWSFSLIHIIPYFKKNVLILSKITGPSAILTQGFATSGILTEIHQSGILVPALQ SE | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 13,504.761 | ||
Theoretical pI: | 5.855 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 46.150 | ||
aromaticity | 0.115 | ||
GRAVY | 0.886 | ||
Secondary Structure Fraction | |||
Helix | 0.484 | ||
turn | 0.238 | ||
sheet | 0.197 |