Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GQ435779.1 | internal | 125 | 2-376(+) |
Amino Acid sequence : | |||
LTHISFSIISVVITIQLMNLLVHELVQLGDASEKGMIATFFSITGLLVTRWIYSGHFPLSDLYESLIFLSWSFSIIHMVPYFRNHRNHFSAITAPSAIFTQGFATSGLLTEMHQSIILVP ALQSQ | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 14,024.183 | ||
Theoretical pI: | 6.374 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 48.233 | ||
aromaticity | 0.120 | ||
GRAVY | 0.640 | ||
Secondary Structure Fraction | |||
Helix | 0.424 | ||
turn | 0.232 | ||
sheet | 0.248 |