Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GQ435883.1 | internal | 162 | 2-487(+) |
Amino Acid sequence : | |||
ETLLGKRVDYSGRSVIVVGPSLSLHQCGLPREIAIELFQTFVIRGLIRQHIASNIGIAKSKIREKEPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPILVEGRAICLHPLVCKGFNA DFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISV | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 17,881.819 | ||
Theoretical pI: | 7.286 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 39.257 | ||
aromaticity | 0.049 | ||
GRAVY | 0.259 | ||
Secondary Structure Fraction | |||
Helix | 0.358 | ||
turn | 0.222 | ||
sheet | 0.290 |