| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >GQ435887.1 | internal | 162 | 2-487(+) |
Amino Acid sequence : | |||
| ETLLGKRVDYSGRSVIVVGPSLSLHQCGLPREIAIELFQTFVIRGLIRQHIASNIGIAKSKIREKEPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPILVEGRAICLHPLVCKGFNA DFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISV | |||
Physicochemical properties | |||
| Number of amino acids: | 162 | ||
| Molecular weight: | 17,881.819 | ||
| Theoretical pI: | 7.286 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 39.257 | ||
| aromaticity | 0.049 | ||
| GRAVY | 0.259 | ||
Secondary Structure Fraction | |||
| Helix | 0.358 | ||
| turn | 0.222 | ||
| sheet | 0.290 | ||