Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GQ503434.1 | internal | 202 | 2-607(+) |
Amino Acid sequence : | |||
RHLFMKNKVRMICDCQAPPVKVVQDKRLAQPLSLCGSTMRSPHGCHAQYMANMGTIASLVMSVTINEDDEETVNDQQIGRKLWGLVVCHHTNPRFVPFPLRYACEFLMQVFGVQVNREVE LAAQTKEKHILQTQTVLCDMLLRDAPVAIVTRSPNVMDLVKCDGAALYYRKKFWMLGVTPTEAQIKDITEWLLEYHGESTGL | |||
Physicochemical properties | |||
Number of amino acids: | 202 | ||
Molecular weight: | 22,948.569 | ||
Theoretical pI: | 7.734 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24450 | ||
Instability index: | 50.088 | ||
aromaticity | 0.069 | ||
GRAVY | -0.116 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.168 | ||
sheet | 0.267 |