| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >GQ865604.1 | complete | 269 | 90-899(+) |
Amino Acid sequence : | |||
| MIAPNLQFPPGFRFHPTDEELVAHYLCRKCASLPLAVPIIAEIDLYKFDPWELPGLASYGEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKATGADKPVGLPKPVAIKKALVFYAGKAPKG EKSNWIMHEYRLADVDRSARKKNSLRLDDWVLCRIYKKKGGEPEREPVGSKFLNPNPNPNPSKLEIKSEIFAHVPPPPVTNDMFYFDTSDSLPRLHADSSCSEHVLSSGFTSETREAESQ LRWGVPTAASDFGFADPFQDIMMYLQKPF* | |||
Physicochemical properties | |||
| Number of amino acids: | 269 | ||
| Molecular weight: | 30,427.315 | ||
| Theoretical pI: | 8.526 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 49390 49640 | ||
| Instability index: | 43.674 | ||
| aromaticity | 0.123 | ||
| GRAVY | -0.551 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.283 | ||
| sheet | 0.242 | ||