Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GS927691.1 | complete | 180 | 61-603(+) |
Amino Acid sequence : | |||
MFDIDEKSKPVSTPLAPHFQLSALMSPSTTDEKKQMERVPYSNAVGALMYTMVCTRLDIFHAVSMVSRYMHNSGKGNWKVVKWIIQYIYGIVDISLKFERDKAEGKHLVGYVDFGYVGDL DKCRSTTGYVFTIAGGPVCWRSTLQSTVALSTTEVEYMDVTKAFKEAIRFLGLTKDLGIV* | |||
Physicochemical properties | |||
Number of amino acids: | 180 | ||
Molecular weight: | 20,228.215 | ||
Theoretical pI: | 8.353 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30035 | ||
Instability index: | 31.617 | ||
aromaticity | 0.111 | ||
GRAVY | -0.039 | ||
Secondary Structure Fraction | |||
Helix | 0.339 | ||
turn | 0.200 | ||
sheet | 0.217 |